PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G29650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 239aa    MW: 26962.2 Da    PI: 8.7553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G29650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.1e-1261105348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       WT+eEde+l ++ k+   ++W ++ar m+ gR++ +c+ rw+ +l
  OMERI02G29650.1  61 EWTAEEDERLRRLAKENLFRQWWKVARGMP-GRSGDSCRARWRHHL 105
                      7*****************************.***********9886 PP

2Myb_DNA-binding23.21.6e-07113156348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++T+ +de lv++++  Gg  W++I+r +  gRt    ++rw +++
  OMERI02G29650.1 113 PFTARDDEELVRLHRHTGGS-WRKISRSVY-GRTSAIMRDRWIQLR 156
                      79****************88.********9.*****9999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.76354109IPR017930Myb domain
SuperFamilySSF466893.56E-2056152IPR009057Homeodomain-like
SMARTSM007171.2E-958107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-1761114IPR009057Homeodomain-like
PfamPF002491.4E-1061104IPR001005SANT/Myb domain
CDDcd001671.34E-1061105No hitNo description
SMARTSM007170.0016110158IPR001005SANT/Myb domain
PROSITE profilePS5129410.852111160IPR017930Myb domain
CDDcd001674.67E-4113155No hitNo description
PfamPF139214.6E-6114157No hitNo description
Gene3DG3DSA:1.10.10.603.9E-9115156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MARREIVDRE DVHEEEDAAG TIPLLSLQPT TIPRRRDDHG YAAGGGAAKC RCSRRRLPER  60
EWTAEEDERL RRLAKENLFR QWWKVARGMP GRSGDSCRAR WRHHLARDVY HRPFTARDDE  120
ELVRLHRHTG GSWRKISRSV YGRTSAIMRD RWIQLRRSGL VPDAAKTAGK AGCPPPAADG  180
DDSEYMGSEA ESKSPPPPQQ QQHPLANVLA SSLDSCTLAS DAMDPRDGIL ALDFAFMSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-136215210100B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0051130.0AP005113.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0685G12.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624539.11e-117PREDICTED: transcription factor MYB98-like
TrEMBLA0A0E0CQV21e-175A0A0E0CQV2_9ORYZ; Uncharacterized protein
STRINGORGLA02G0262900.11e-116(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2205166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.17e-23myb domain protein r1